Structure of PDB 5l6n Chain H

Receptor sequence

>5l6nH (length=254) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGKG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
QFGE

3D structure

• PDB: 5l6n Tyrosine sulfation modulates activity of tick-derived thrombin inhibitors.
• Chain: H
• Resolution: 1.627 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E328 G330 M331 P333 W334 D433 H436 P437 C439 G453 Y454 K455 R457 N484 K532 P534 N537 R538 W539	E8 G10 M11 P13 W14 D113 H116 P117 C119 G133 Y134 K135 R137 N159 K207 P209 N212 R213 W214
BS02	peptide	H	H363 Y367 W370 H407 R409 R413 E414 R418 R443 R498 I499 N504 D519 A520 E522 S525 W547 F564 R565 L566 K568 K572	H43 Y47 W50 H87 R89 R93 E94 R98 R123 R173 I174 N179 D194 A195 E197 S200 W222 F239 R240 L241 K243 K247

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:5l6n, PDBe:5l6n, PDBj:5l6n
• PDBsum: 5l6n
• PubMed: 28837178
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)