Structure of PDB 5hw8 Chain H

Receptor sequence

>5hw8H (length=100) Species: 237561 (Candida albicans SC5314)

QIEIVQEAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKG
WDISLTNNYPKISKGTKAILTIPPNLAPRGIPGIIGPNETLVFEVELLGV

3D structure

• PDB: 5hw8 Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
• Chain: H
• Resolution: 2.86 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y30 F40 D41 I60 F114
• Catalytic site (residue number reindexed from 1): Y18 F28 D29 I48 F93
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FK5	H	Y30 F40 D41 F50 Q58 V59 I60 W63 I105 F114	Y18 F28 D29 F38 Q46 V47 I48 W51 I84 F93

Gene Ontology

Molecular Function

• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0003755 peptidyl-prolyl cis-trans isomerase activity
• GO:0005527 macrolide binding
• GO:0044183 protein folding chaperone

Biological Process

• GO:0006325 chromatin organization
• GO:0006366 transcription by RNA polymerase II
• GO:0006412 translation
• GO:0006457 protein folding
• GO:0045454 cell redox homeostasis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0070651 nonfunctional rRNA decay
• GO:1901710 regulation of homoserine biosynthetic process
• GO:1903644 regulation of chaperone-mediated protein folding

Cellular Component

• GO:0005576 extracellular region
• GO:0005737 cytoplasm
• GO:0062040 fungal biofilm matrix

External links

• PDB: RCSB:5hw8, PDBe:5hw8, PDBj:5hw8
• PDBsum: 5hw8
• PubMed: 27118592
• UniProt: P28870|FKBP_CANAL FK506-binding protein 1 (Gene Name=RBP1)