Structure of PDB 5h4p Chain H

Receptor sequence

>5h4pH (length=191) Species: 559292 (Saccharomyces cerevisiae S288C)

MKYIQTEQQIEVPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNN
QLIKVAVHNGGRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN
VNIVEKDGAKFIEVRNFLGDKKIRNVPVRDGVTIEFSTNVKDEIVLSGNS
VEDVSQNAADLQQICRVRNKDIRKFLDGIYVSHKGFITEDL

3D structure

• PDB: 5h4p Structural snapshot of cytoplasmic pre-60S ribosomal particles bound by Nmd3, Lsg1, Tif6 and Reh1
• Chain: H
• Resolution: 3.07 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	S19 S22 R23 K26 H40 D42 V43 T44 V57 H58 R62 K63 A66 R69 T70 S73 N77 H96 F97 D120 K121 K122 V151 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 K184	S19 S22 R23 K26 H40 D42 V43 T44 V57 H58 R62 K63 A66 R69 T70 S73 N77 H96 F97 D120 K121 K122 V151 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 K184

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5h4p, PDBe:5h4p, PDBj:5h4p
• PDBsum: 5h4p
• PubMed: 28112732
• UniProt: P05738|RL9A_YEAST Large ribosomal subunit protein uL6A (Gene Name=RPL9A)