Structure of PDB 5h4d Chain H

Receptor sequence

>5h4dH (length=271) Species: 9606 (Homo sapiens)

GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ
YDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKG
LLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRA
DVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGT
SLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGV
ESLVELLGWTEEMRDLVQRET

3D structure

• PDB: 5h4d Crystal structure of hSIRT3 in complex with a specific agonist Amiodarone hydrochloride
• Chain: H
• Resolution: 3.21 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	F180 H248 V292 F293 F294 G295 E296 L298	F60 H128 V172 F173 F174 G175 E176 L178
BS02	ZN	H	C256 C259 C280 C283	C136 C139 C160 C163
BS03	BBI	H	R158 E177 F294 V324	R38 E57 F174 V204
BS04	NAD	H	G145 A146 G147 T150 Q228 N229 I230 D231 H248 S321 N344 V366	G25 A26 G27 T30 Q108 N109 I110 D111 H128 S201 N224 V246

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:5h4d, PDBe:5h4d, PDBj:5h4d
• PDBsum: 5h4d
• UniProt: Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)