Structure of PDB 5gmk Chain H

Receptor sequence
>5gmkH (length=95) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEWK
RQVSKEIKQKSTRIYDPSLNEMQIAELNDELNNLFKEWKRWQWHI
3D structure
PDB5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
ChainH
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H S30 R31 S29 R30
BS02 rna H S2 R36 N37 R91 S1 R35 N36 R90
BS03 rna H S2 K56 K59 S1 K55 K58
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000389 mRNA 3'-splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0071020 post-spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gmk, PDBe:5gmk, PDBj:5gmk
PDBsum5gmk
PubMed27445308
UniProtP21374|ISY1_YEAST Pre-mRNA-splicing factor ISY1 (Gene Name=ISY1)

[Back to BioLiP]