Structure of PDB 5g4u Chain H

Receptor sequence
>5g4uH (length=117) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence]
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIA
EDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINE
GELRKELGSLVEKIKGL
3D structure
PDB5g4u A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
ChainH
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H N33 E34 K37 N33 E34 K37
BS02 rna H K30 G31 T32 N33 E34 D54 K79 I88 E89 V90 C92 A93 K30 G31 T32 N33 E34 D54 K79 I88 E89 V90 C92 A93
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5g4u, PDBe:5g4u, PDBj:5g4u
PDBsum5g4u
PubMed27506301
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]