Structure of PDB 5fvb Chain H

Receptor sequence

>5fvbH (length=164) Species: 865859 (Phormidium rubidum A09DM) [Search protein sequence]

MKSVVTTVIAAADAAGRFPSSSDLESVQGSIQRSAARLEAAEKLAGNIDA
VAQEAYNACIQKYPYLNNSGEANSTDTFKAKCLRDVKHYMRLIQYSLVVG
GTGPLDEWGIAGQREVYRALGLPTAPYVEALSFARNRGCAPRDMSAQALT
EYNALLDYAINSLS

3D structure

PDB

5fvb Crystal Structure Analysis of C-Phycoerythrin from Marine Cyanobacterium Phormidium Sp. A09Dm.

Chain

Resolution

1.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	H	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L120 L122 P126 Y127	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L120 L122 P126 Y127
BS02	PEB	H	L44 N47 V51 E54 R137 C139 R142 D143 Y152	L44 N47 V51 E54 R137 C139 R142 D143 Y152
BS03	PEB	H	L24 E25 Q28	L24 E25 Q28
BS04	PEB	H	R33 Q147	R33 Q147

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5fvb, PDBe:5fvb, PDBj:5fvb
PDBsum	5fvb
PubMed	27068646
UniProt	A0A0E3W010

[Back to BioLiP]