Structure of PDB 5cmx Chain H

Receptor sequence

>5cmxH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ

3D structure

• PDB: 5cmx Different duplex/quadruplex junctions determine the properties of anti-thrombin aptamers with mixed folding.
• Chain: H
• Resolution: 2.98 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 C122 Y134 K135 G136 R137 N159 K202 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 C119 Y134 K135 G136 R137 N157 K205 R211 W212
BS02	dna	H	I24 R75 Y76 E77 R77A I79	I9 R70 Y71 E72 R73 I75
BS03	0G6	H	H57 Y60A W60D L99 D189 A190 E192 G193 S195 S214 W215 G216	H43 Y47 W50 L96 D192 A193 E195 G196 S198 S219 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:5cmx, PDBe:5cmx, PDBj:5cmx
• PDBsum: 5cmx
• PubMed: 26673709
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)