Structure of PDB 5c0x Chain H

Receptor sequence

>5c0xH (length=293) Species: 559292 (Saccharomyces cerevisiae S288C)

SEVITITKRNGAFQNSSDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSS
VAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQH
AVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSAS
LHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWL
RKTSQMDLARDTSSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIG
ITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRG

3D structure

• PDB: 5c0x RNA degradation paths in a 12-subunit nuclear exosome complex.
• Chain: H
• Resolution: 3.812 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	R123 S175	R90 S142

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
• GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000956 nuclear-transcribed mRNA catabolic process
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0006401 RNA catabolic process
• GO:0034475 U4 snRNA 3'-end processing
• GO:0071028 nuclear mRNA surveillance
• GO:0071034 CUT catabolic process
• GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
• GO:0071038 TRAMP-dependent tRNA surveillance pathway
• GO:0071051 poly(A)-dependent snoRNA 3'-end processing

Cellular Component

• GO:0000176 nuclear exosome (RNase complex)
• GO:0000177 cytoplasmic exosome (RNase complex)
• GO:0000178 exosome (RNase complex)
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:5c0x, PDBe:5c0x, PDBj:5c0x
• PDBsum: 5c0x
• PubMed: 26222026
• UniProt: P38792|RRP4_YEAST Exosome complex component RRP4 (Gene Name=RRP4)