Structure of PDB 5bqq Chain H

Receptor sequence

>5bqqH (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPGH

3D structure

• PDB: 5bqq Rational steering of insulin binding specificity by intra-chain chemical crosslinking.
• Chain: H
• Resolution: 1.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	C7 L11 L15 V18 C19 R22 G23 Y26	C7 L11 L15 V18 C19 R22 G23 Y26
BS02	peptide	H	F1 V2 H5	F1 V2 H5

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:5bqq, PDBe:5bqq, PDBj:5bqq
• PDBsum: 5bqq
• PubMed: 26792393
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)