Structure of PDB 5bmg Chain H |
>5bmgH (length=56) Species: 1320 (Streptococcus sp. 'group G') [Search protein sequence] |
MQYKLILNGKTLKGCTTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATK TFTVTE |
|
PDB | 5bmg Rotameric preferences of a protein spin label at edge-strand beta-sheet sites. |
Chain | H |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MTN |
H |
K4 C15 |
K4 C15 |
|
|
|
|