Structure of PDB 5ahg Chain H

Receptor sequence

>5ahgH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 5ahg Fragments Can Bind Either More Enthalpy or Entropy-Driven: Crystal Structures and Residual Hydration Pattern Suggest Why.
• Chain: H
• Resolution: 1.24 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	F34 L40 L65 R73 T74 R75 Y76 K81 I82	F19 L26 L60 R68 T69 R70 Y71 K77 I78
BS02	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 G10 M11 P13 W14 D112 H115 P116 C118 Y133 K134 R136 N156 M203 K204 N209 R210 W211
BS03	Y4L	H	D189 A190 C191 E192 V213 W215 G216 G219 C220 G226 F227	D191 A192 C193 E194 V217 W219 G220 G222 C223 G230 F231

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:5ahg, PDBe:5ahg, PDBj:5ahg
• PDBsum: 5ahg
• PubMed: 26270568
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)