Structure of PDB 4wf9 Chain H

Receptor sequence
>4wf9H (length=122) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGG
VVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFG
PVARELREGNFMKIVSLAPEVL
3D structure
PDB4wf9 Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
ChainH
Resolution3.427 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H M1 Q3 Q4 E5 T6 I22 K23 G26 G27 S28 G29 R30 T42 K66 Y76 M1 Q3 Q4 E5 T6 I22 K23 G26 G27 S28 G29 R30 T42 K66 Y76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wf9, PDBe:4wf9, PDBj:4wf9
PDBsum4wf9
PubMed26464510
UniProtQ2FW16|RL14_STAA8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]