Structure of PDB 4tni Chain H

Receptor sequence
>4tniH (length=65) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKALG
3D structure
PDB4tni Taking snapshots of photosynthetic water oxidation using femtosecond X-ray diffraction and spectroscopy.
ChainH
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H T27 M31 F34 M35 T26 M30 F33 M34
BS02 CLA H T5 L7 T4 L6
BS03 CLA H F38 F41 I45 L46 Y49 F37 F40 I44 L45 Y48
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tni, PDBe:4tni, PDBj:4tni
PDBsum4tni
PubMed25006873
UniProtQ8DJ43|PSBH_THEVB Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]