Structure of PDB 4q9n Chain H

Receptor sequence
>4q9nH (length=295) Species: 1340853 (Chlamydia trachomatis F/11-96) [Search protein sequence]
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFS
QSLELGKFNASRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKD
LSGYTVSEVVEQVKKHFGHIDILVHSLANSPEIAKPLLDTSRKGYLAALS
TSSYSFISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALE
SDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERMVDYYQDWAPL
PSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMF
3D structure
PDB4q9n Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.
ChainH
Resolution1.795 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAI H G21 Y22 W42 D79 S126 L127 A128 T151 L176 T177 K196 A223 P225 L226 S228 A230 G21 Y22 W42 D79 S126 L127 A128 T151 L176 T177 K196 A223 P225 L226 S228 A230
BS02 0WE H N129 S130 I133 Y178 G187 Y188 A230 A233 I234 F236 M240 N129 S130 I133 Y178 G187 Y188 A230 A233 I234 F236 M240 MOAD: ic50=0.95uM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Nov 22 21:28:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4q9n', asym_id = 'H', title = 'Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4q9n', asym_id='H', title='Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '4q9n', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='4q9n', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>