Structure of PDB 4or5 Chain H

Receptor sequence
>4or5H (length=48) Species: 11706 (HIV-1 M:B_HXB2R) [Search protein sequence]
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYG
3D structure
PDB4or5 Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4.
ChainH
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN H C22 H33 C34 C37 C22 H33 C34 C37
BS02 ZN H C25 C30 C25 C30
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
Biological Process
GO:0050434 positive regulation of viral transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4or5, PDBe:4or5, PDBj:4or5
PDBsum4or5
PubMed24727379
UniProtP04608|TAT_HV1H2 Protein Tat (Gene Name=tat)

[Back to BioLiP]