Structure of PDB 4mne Chain H

Receptor sequence

>4mneH (length=275) Species: 9606 (Homo sapiens)

DDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL
QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQI
LGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPP
PPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL
MVHAFIKRSDAEEVDFAGWLCSTIG

3D structure

• PDB: 4mne Structure of the BRAF-MEK Complex Reveals a Kinase Activity Independent Role for BRAF in MAPK Signaling.
• Chain: H
• Resolution: 2.8483 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D190 K192 S194 N195 D208 D217 T226
• Catalytic site (residue number reindexed from 1): D125 K127 S129 N130 D143 D152 T161
• Enzyme Commision number: 2.7.12.2: mitogen-activated protein kinase kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACP	H	L74 G75 A76 G77 G80 A95 K97 M143 M146 S150 Q153 K192 S194 L197	L9 G10 A11 G12 G15 A30 K32 M78 M81 S85 Q88 K127 S129 L132
BS02	MG	H	N195 D208	N130 D143
BS03	573	H	K97 L118 V127 I141 M143 D208 F209 G210 V211 S212 L215 M219	K32 L53 V62 I76 M78 D143 F144 G145 V146 S147 L150 M154	BindingDB: EC50=7.2nM,IC50=35nM
BS04	573	H	H87 L92 M94 H119 Y130	H22 L27 M29 H54 Y65	BindingDB: EC50=7.2nM,IC50=35nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:4mne, PDBe:4mne, PDBj:4mne
• PDBsum: 4mne
• PubMed: 25155755
• UniProt: Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 (Gene Name=MAP2K1)