Structure of PDB 4lz1 Chain H

Receptor sequence

>4lz1H (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 4lz1 Dissecting the contribution of thrombin exosite I in the recognition of thrombin binding aptamer.
• Chain: H
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 G136 R137 N159 K202 N205 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 G136 R137 N156 K204 N209 R210 W211
BS02	dna	H	I24 R75 Y76 E77 R77A I79 Y117	I9 R70 Y71 E72 R73 I75 Y114
BS03	0G6	H	H57 Y60A W60D L99 D189 A190 S195 S214 W215 G216	H43 Y47 W50 L96 D191 A192 S197 S218 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:4lz1, PDBe:4lz1, PDBj:4lz1
• PDBsum: 4lz1
• PubMed: 24128303
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)