Structure of PDB 4kud Chain H

Receptor sequence
>4kudH (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQ
3D structure
PDB4kud N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain.
ChainH
Resolution3.203 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R36 E38 T39 Y43 R1 E3 T4 Y8 PDBbind-CN: Kd=0.04uM
BS02 dna H R36 Y45 Q59 K89 S90 T91 R1 Y10 Q24 K54 S55 T56 PDBbind-CN: Kd=0.04uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kud, PDBe:4kud, PDBj:4kud
PDBsum4kud
PubMed23934152
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]