Structure of PDB 4i7y Chain H

Receptor sequence

>4i7yH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 4i7y Duplex-quadruplex motifs in a peculiar structural organization cooperatively contribute to thrombin binding of a DNA aptamer.
• Chain: H
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 W29 D116 H119 P120 C122 Y134 K135 R137 N159 K202 P204 N205 R206 W207	E8 I9 G10 M11 W14 D113 H116 P117 C119 Y134 K135 R137 N156 K204 P206 N209 R210 W211
BS02	dna	H	H91 P92 R93 Y94 N95 W96 R97 R126 L130 H230 R233 W237 Q244 F245	H87 P88 R89 Y90 N91 W92 R93 R123 L130 H234 R237 W241 Q248 F249	PDBbind-CN: Kd=0.7nM
BS03	0G6	H	H57 Y60A L99 D189 A190 S195 S214 W215 G216	H43 Y47 L96 D191 A192 S197 S218 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:4i7y, PDBe:4i7y, PDBj:4i7y
• PDBsum: 4i7y
• PubMed: 24311581
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)