Structure of PDB 4h1l Chain H |
>4h1lH (length=111) Species: 562 (Escherichia coli) [Search protein sequence] |
GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIV NDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSLRDGYTGE LFFGEGSRLTV |
|
PDB | 4h1l T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy. |
Chain | H |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
H |
D28 R94 D95 G96 |
D28 R94 D95 G96 |
|
|
|
|