Structure of PDB 4e7r Chain H

Receptor sequence

>4e7rH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 4e7r New 3-amidinophenylalanine-derived inhibitors of matriptase
• Chain: H
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 N209 R210 W211
BS02	peptide	H	F34 L40 R67 R73 T74 R75 Y76 I82	F19 L26 R62 R68 T69 R70 Y71 I78
BS03	0NW	H	H57 Y60A W60D N98 L99 D189 A190 C191 E192 S195 V213 W215 G216 G219	H43 Y47 W50 N95 L96 D191 A192 C193 E194 S197 V217 W219 G220 G222	PDBbind-CN: -logKd/Ki=7.70,Ki=0.02uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:4e7r, PDBe:4e7r, PDBj:4e7r
• PDBsum: 4e7r
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)