Structure of PDB 4e2f Chain H |
>4e2fH (length=144) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
EAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLI KIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNVLVC PNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN |
|
PDB | 4e2f Trapping and structure determination of an intermediate in the allosteric transition of aspartate transcarbamoylase. |
Chain | H |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
H |
C114 C138 C141 |
C105 C129 C132 |
|
|
|
|