Structure of PDB 4d4p Chain H |
>4d4pH (length=74) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
SMSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEEKVAVCPSC SLMIDVVFDKEDLAEYYEEAGIHP |
|
PDB | 4d4p Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2. |
Chain | H |
Resolution | 2.999 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
H |
C368 C370 C390 C393 |
C26 C28 C47 C50 |
|
|
|
|