Structure of PDB 4cj8 Chain H

Receptor sequence
>4cj8H (length=247) Species: 28116 (Bacteroides ovatus) [Search protein sequence]
SHMRIGILYICTGKYDIFWKDFYLSAERYFMQDQSFIIEYYVFTDSPKLY
DEENNKHIHRIKQKNLGWPDNTLKRFHIFLRIKEQLERETDYLFFFNANL
LFTSPIGKEILPPSDSNGLLGTMHPGFYNKPNSEFTYERRDASTAYIPEG
EGRYYYAGGLSGGCTKAYLKLCTTICSWVDRDATNHIIPIWHDQSLINKY
FLDNPPAITLSPAYLYPEGWLLPFEPIILIRDKNKPQYGGHELLRRK
3D structure
PDB4cj8 Structures of Complexes of a Metal-Independent Glycosyltransferase Gt6 from Bacteroides Ovatus with Udp-Galnac and its Hydrolysis Products
ChainH
Resolution3.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 UD2 H I8 C9 T10 Y13 N69 R73 N95 A96 G156 G157 D191 Q192 K231 R243 I10 C11 T12 Y15 N71 R75 N97 A98 G158 G159 D193 Q194 K233 R245
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Mar 3 04:28:19 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4cj8', asym_id = 'H', title = 'Structures of Complexes of a Metal-Independent G...atus with Udp-Galnac and its Hydrolysis Products '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4cj8', asym_id='H', title='Structures of Complexes of a Metal-Independent G...atus with Udp-Galnac and its Hydrolysis Products ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005975,0016020,0016758', uniprot = '', pdbid = '4cj8', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005975,0016020,0016758', uniprot='', pdbid='4cj8', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>