Structure of PDB 4asu Chain H

Receptor sequence
>4asuH (length=83) Species: 9913 (Bos taurus) [Search protein sequence]
FTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHA
EDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTL
3D structure
PDB4asu Structural Evidence of a New Catalytic Intermediate in the Pathway of ATP Hydrolysis by F1-ATPase from Bovine Heart Mitochondria.
ChainH
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide H V57 P60 S78 S79 G80 E95 E96 V40 P43 S61 S62 G63 E78 E79
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4asu, PDBe:4asu, PDBj:4asu
PDBsum4asu
PubMed22733764
UniProtP05630|ATPD_BOVIN ATP synthase subunit delta, mitochondrial (Gene Name=ATP5F1D)

[Back to BioLiP]