Structure of PDB 4aso Chain H |
>4asoH (length=93) Species: 1428 (Bacillus thuringiensis) [Search protein sequence] |
FYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKP TVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA |
|
PDB | 4aso Superstructure of the Centromeric Complex of Tubzrc Plasmid Partitioning Systems. |
Chain | H |
Resolution | 7.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
T44 K54 P55 F58 |
T39 K49 P50 F53 |
|
|
|
|