Structure of PDB 3wu2 Chain H

Receptor sequence
>3wu2H (length=63) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKA
3D structure
PDB3wu2 Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
ChainH
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F38 F41 I45 L46 Y49 F37 F40 I44 L45 Y48
BS02 CLA H T27 M31 F34 T26 M30 F33
BS03 CLA H T5 G8 T4 G7
BS04 RRX H M35 F38 F41 I44 L55 M34 F37 F40 I43 L54
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wu2, PDBe:3wu2, PDBj:3wu2
PDBsum3wu2
PubMed21499260
UniProtP19052|PSBH_THEVL Photosystem II reaction center protein H (Fragment) (Gene Name=psbH)

[Back to BioLiP]