Structure of PDB 3wtn Chain H

Receptor sequence
>3wtnH (length=208) Species: 6523 (Lymnaea stagnalis) [Search protein sequence]
AEAADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNE
VDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEV
LTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHS
REISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEV
SLNFRKKG
3D structure
PDB3wtn Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
ChainH
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 N2Y H W53 A103 R104 L112 W56 A106 R107 L115 MOAD: Kd=0.091uM
BS02 N2Y H Y89 W143 Y192 Y92 W146 Y195 MOAD: Kd=0.091uM
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0006811 monoatomic ion transport
GO:0007165 signal transduction
GO:0007268 chemical synaptic transmission
GO:0034220 monoatomic ion transmembrane transport
GO:0042391 regulation of membrane potential
GO:0050877 nervous system process
GO:0060078 regulation of postsynaptic membrane potential
GO:0060079 excitatory postsynaptic potential
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0043005 neuron projection
GO:0043083 synaptic cleft
GO:0045202 synapse
GO:0098794 postsynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wtn, PDBe:3wtn, PDBj:3wtn
PDBsum3wtn
PubMed25267717
UniProtP58154|ACHP_LYMST Acetylcholine-binding protein

[Back to BioLiP]