Structure of PDB 3utu Chain H

Receptor sequence

>3utuH (length=249) Species: 9606 (Homo sapiens)

VEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWD
KNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIA
LMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPSV
LQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPF
VMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 3utu Beyond heparinization: design of highly potent thrombin inhibitors suitable for surface coupling
• Chain: H
• Resolution: 1.55 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E7 G9 M10 P12 W13 D112 H115 P116 C118 Y133 K134 R136 N155 M202 K203 N208 R209 W210
BS02	peptide	H	F34 L65 R67 R73 T74 Y76 K81 I82	F18 L59 R61 R67 T68 Y70 K76 I77
BS03	1TS	H	Y60A W60D E97A N98 L99 D189 A190 V213 W215 G216 E217 G219 R221A	Y46 W49 E93 N94 L95 D190 A191 V216 W218 G219 E220 G221 R224	MOAD: Ki=0.012nM PDBbind-CN: -logKd/Ki=10.92,Ki=0.012nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3utu, PDBe:3utu, PDBj:3utu
• PDBsum: 3utu
• PubMed: 22907907
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)