Structure of PDB 3u8r Chain H

Receptor sequence

>3u8rH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG
E

3D structure

• PDB: 3u8r Rational design and characterization of D-Phe-Pro-D-Arg-derived direct thrombin inhibitors.
• Chain: H
• Resolution: 1.47 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	S325 D326 E328 G330 M331 P333 W334 D433 H436 P437 C439 Y454 K455 R457 N484 K532 P534 R538 W539	S5 D6 E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N156 K204 P206 R210 W211
BS02	peptide	H	H363 W370 N415 L416 I499 D519 A520 E522 S525 S546 W547 G548	H43 W50 N95 L96 I171 D191 A192 E194 S197 S218 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3u8r, PDBe:3u8r, PDBj:3u8r
• PDBsum: 3u8r
• PubMed: 22457833
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)