Structure of PDB 3pip Chain H

Receptor sequence
>3pipH (length=134) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDI
IVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIIN
NQGEPRGTRVFGPVARELRDRRFMKIVSLAPEVL
3D structure
PDB3pip Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
ChainH
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H M1 M3 Q5 S6 R7 I22 R23 T35 T36 G37 G38 N41 K42 R43 Y44 S54 K56 V69 A80 K82 T88 R90 N94 M1 M3 Q5 S6 R7 I22 R23 T35 T36 G37 G38 N41 K42 R43 Y44 S54 K56 V69 A80 K82 T88 R90 N94
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pip, PDBe:3pip, PDBj:3pip
PDBsum3pip
PubMed21282615
UniProtQ9RXJ2|RL14_DEIRA Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]