Structure of PDB 3p6z Chain H

Receptor sequence

>3p6zH (length=255) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQFGE

3D structure

• PDB: 3p6z Structural basis of thrombin-mediated factor V activation: the Glu666-Glu672 sequence is critical for processing at the heavy chain-B domain junction.
• Chain: H
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E371 G373 M374 P376 W377 D476 H479 P480 C482 Y497 K498 R500 N527 M574 K575 N580 R581 W582	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N160 M207 K208 N213 R214 W215
BS02	peptide	H	F382 R431 T432 R433 Y434 R436	F19 R68 T69 R70 Y71 R73
BS03	0G6	H	H406 W413 L459 I542 D562 A563 S568 S589 W590 G591	H43 W50 L96 I175 D195 A196 S201 S222 W223 G224

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3p6z, PDBe:3p6z, PDBj:3p6z
• PDBsum: 3p6z
• PubMed: 21555742
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)