Structure of PDB 3p33 Chain H

Receptor sequence

>3p33H (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 3p33 Diabetes-associated mutations in human insulin: crystal structure and photo-cross-linking studies of a-chain variant insulin Wakayama.
• Chain: H
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	C7 L11 L15 V18 C19 R22 G23 F24	C7 L11 L15 V18 C19 R22 G23 F24

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3p33, PDBe:3p33, PDBj:3p33
• PDBsum: 3p33
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)