Structure of PDB 3mgs Chain H

Receptor sequence
>3mgsH (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB3mgs Perturbations in nucleosome structure from heavy metal association.
ChainH
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H K24 R26 R27 R30 K31 E32 S33 I36 Y37 K1 R3 R4 R7 K8 E9 S10 I13 Y14
BS02 dna H K25 R26 R27 K28 T29 R30 S52 S53 R83 S84 T85 K2 R3 R4 K5 T6 R7 S29 S30 R60 S61 T62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3mgs, PDBe:3mgs, PDBj:3mgs
PDBsum3mgs
PubMed20494975
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]