Structure of PDB 3m2m Chain H

Receptor sequence

>3m2mH (length=132) Species: 10116 (Rattus norvegicus) [Search protein sequence]

GLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAH
GDANTIVCNSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKLPD
GHEFKFPNRLNMEAINYMAADGDFKIKCVAFE

3D structure

PDB

3m2m Monovalent interactions of galectin-1.

Chain

Resolution

2.95 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	H	R48 E71 R73	R46 E69 R71
BS02	GAL	H	H44 R48 H52 N61 E71	H42 R46 H50 N59 E69

Gene Ontology

	Biological Process
GO:0002317	plasma cell differentiation
GO:0006915	apoptotic process
GO:0009410	response to xenobiotic stimulus
GO:0010812	negative regulation of cell-substrate adhesion
GO:0010977	negative regulation of neuron projection development
GO:0031295	T cell costimulation
GO:0034120	positive regulation of erythrocyte aggregation
GO:0035900	response to isolation stress
GO:0043065	positive regulation of apoptotic process
GO:0045185	maintenance of protein location
GO:0045445	myoblast differentiation
GO:0046598	positive regulation of viral entry into host cell
GO:0048678	response to axon injury
GO:0050729	positive regulation of inflammatory response
GO:0071333	cellular response to glucose stimulus
GO:0071407	cellular response to organic cyclic compound
GO:0098609	cell-cell adhesion
GO:2001200	positive regulation of dendritic cell differentiation

External links

PDB	RCSB:3m2m, PDBe:3m2m, PDBj:3m2m
PDBsum	3m2m
PubMed	20873803
UniProt	P11762\|LEG1_RAT Galectin-1 (Gene Name=Lgals1)