Structure of PDB 3lk4 Chain H

Receptor sequence

>3lk4H (length=239) Species: 9031 (Gallus gallus) [Search protein sequence]

SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAR
DKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEAN
NAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSD
SSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR

3D structure

PDB

3lk4 Structural characterization of a capping protein interaction motif defines a family of actin filament regulators.

Chain

Resolution

1.99 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	D7 L10 D11 R14 S42 D44 D63 Y64 R66 D67 G68 D69 D85 W122 A129 V153 T194	D6 L9 D10 R13 S41 D43 D62 Y63 R65 D66 G67 D68 D84 W121 A128 V152 T189

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0051015	actin filament binding

	Biological Process
GO:0000902	cell morphogenesis
GO:0007010	cytoskeleton organization
GO:0008154	actin polymerization or depolymerization
GO:0010591	regulation of lamellipodium assembly
GO:0022604	regulation of cell morphogenesis
GO:0030030	cell projection organization
GO:0030032	lamellipodium assembly
GO:0030036	actin cytoskeleton organization
GO:0051016	barbed-end actin filament capping
GO:0051490	negative regulation of filopodium assembly
GO:0051693	actin filament capping

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005903	brush border
GO:0008290	F-actin capping protein complex
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0030018	Z disc
GO:0030027	lamellipodium
GO:0030863	cortical cytoskeleton
GO:0031674	I band
GO:0032279	asymmetric synapse
GO:0071203	WASH complex
GO:0098685	Schaffer collateral - CA1 synapse
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0120212	sperm head-tail coupling apparatus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3lk4, PDBe:3lk4, PDBj:3lk4
PDBsum	3lk4
PubMed	20357771
UniProt	P14315\|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]