Structure of PDB 3lk4 Chain H

Receptor sequence
>3lk4H (length=239) Species: 9031 (Gallus gallus) [Search protein sequence]
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAR
DKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEAN
NAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQERTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSD
SSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
3D structure
PDB3lk4 Structural characterization of a capping protein interaction motif defines a family of actin filament regulators.
ChainH
Resolution1.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide H D7 L10 D11 R14 S42 D44 D63 Y64 R66 D67 G68 D69 D85 W122 A129 V153 T194 D6 L9 D10 R13 S41 D43 D62 Y63 R65 D66 G67 D68 D84 W121 A128 V152 T189
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0051015 actin filament binding
Biological Process
GO:0000902 cell morphogenesis
GO:0007010 cytoskeleton organization
GO:0008154 actin polymerization or depolymerization
GO:0010591 regulation of lamellipodium assembly
GO:0022604 regulation of cell morphogenesis
GO:0030030 cell projection organization
GO:0030032 lamellipodium assembly
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
GO:0051490 negative regulation of filopodium assembly
GO:0051693 actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005903 brush border
GO:0008290 F-actin capping protein complex
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030018 Z disc
GO:0030027 lamellipodium
GO:0030863 cortical cytoskeleton
GO:0031674 I band
GO:0032279 asymmetric synapse
GO:0071203 WASH complex
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0120212 sperm head-tail coupling apparatus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3lk4, PDBe:3lk4, PDBj:3lk4
PDBsum3lk4
PubMed20357771
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]