Structure of PDB 3lel Chain H

Receptor sequence
>3lelH (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
RKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB3lel Structural insight into the sequence dependence of nucleosome positioning
ChainH
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R30 K31 E32 S33 R4 K5 E6 S7
BS02 dna H R27 K28 T29 R30 S53 R83 S84 T85 R1 K2 T3 R4 S27 R57 S58 T59
BS03 dna H Q44 V45 H46 D48 Q18 V19 H20 D22
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3lel, PDBe:3lel, PDBj:3lel
PDBsum3lel
PubMed20399189
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]