Structure of PDB 3jca Chain H

Receptor sequence

>3jcaH (length=49) Species: 11757 (Mouse mammary tumor virus)

PMVMWKDLLTGSWKGPDVLITAGRGYACVFPQDAESPIWVPDRFIRPFT

3D structure

• PDB: 3jca Cryo-EM reveals a novel octameric integrase structure for betaretroviral intasome function.
• Chain: H
• Resolution: 4.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.26.4: ribonuclease H.
  3.4.23.-
  3.6.1.23: dUTP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	H	R240 G241 Y242 W255 R259	R24 G25 Y26 W39 R43

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

External links

• PDB: RCSB:3jca, PDBe:3jca, PDBj:3jca
• PDBsum: 3jca
• PubMed: 26887496
• UniProt: P03365|POL_MMTVB Gag-Pro-Pol polyprotein (Gene Name=gag-pro-pol)