Structure of PDB 3jbn Chain H

Receptor sequence

>3jbnH (length=204) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

MKLNISNPLNNVQKSIEIDDEKKLLPFMEKRIGNAVPGDSIGEEFTGYVF
RITGGNDKQGFPMIQGVLTNNRVRLLFKKGMKCYRPRKKGERKRKSVRGC
IVGQDLSALNLTLVKKGVNEIPGLTDKAVGKKLGPKRASKIRKLFNLDKS
DDVRKYVIIGFIKPKIQRLVTEKRLLRKRNLLQAKDKRRLEKKQQLKEYK
QLLN

3D structure

PDB

3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K2 N4 N11 Q13 S15 R31 R51 T53 N56 K58 Q59 G60 Q65 G66 R74 K78 K82 C83 Y84 R85 R87 K88 K89 G90 R92 K93 R94 K95 S96 S107 N110 K115 K131 K132 L133 G134 P135 K136 R137 S139 K140 R142 K143 K149 I158 I159 F170 I171 K172 P173 K174 Q176 R177 V179 R183 L184 R186 K187 L190 K194 R197 R198 K201 K202	K2 N4 N11 Q13 S15 R31 R51 T53 N56 K58 Q59 G60 Q65 G66 R74 K78 K82 C83 Y84 R85 R87 K88 K89 G90 R92 K93 R94 K95 S96 S107 N110 K115 K131 K132 L133 G134 P135 K136 R137 S139 K140 R142 K143 K149 I158 I159 F161 I162 K163 P164 K165 Q167 R168 V170 R174 L175 R177 K178 L181 K185 R188 R189 K192 K193

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	Q8IDR9

[Back to BioLiP]