Structure of PDB 3j9m Chain H

Receptor sequence
>3j9mH (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
TVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSV
ENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLR
3D structure
PDB3j9m Ribosome. The structure of the human mitochondrial ribosome.
ChainH
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H W60 K61 P63 L64 H74 R75 R76 D85 K87 H88 N121 W8 K9 P11 L12 H22 R23 R24 D33 K35 H36 N69
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
PDBsum3j9m
PubMed25838379
UniProtQ9BYD2|RM09_HUMAN Large ribosomal subunit protein bL9m (Gene Name=MRPL9)

[Back to BioLiP]