Structure of PDB 3j6b Chain H

Receptor sequence

>3j6bH (length=148) Species: 4932 (Saccharomyces cerevisiae)

SQKIGHSGLAFARLWHHVDVARDKRTLGRLASAIAITLIGRHKPVYHPSQ
DCGDYVVVTNCQKIRVTGKKFEQKTYWSHSGRPGQLKLQTMNKVVADKGF
GEILKKAVSGMLPKNKLRKQRLDRLKVFDGSENPYKQNITAFAHEQSS

3D structure

• PDB: 3j6b Structure of the yeast mitochondrial large ribosomal subunit.
• Chain: H
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	R23 K25 R26 T27 L28 G29 R30 S33 R42 H48 P49 S50 Y56 R66 T68 K71 Q74 Y77 W78 H80 R83 P84 G85 K94 A108 G111 M112 P114 N116 K117 R119 P135 Y136	R22 K24 R25 T26 L27 G28 R29 S32 R41 H47 P48 S49 Y55 R65 T67 K70 Q73 Y76 W77 H79 R82 P83 G84 K93 A107 G110 M111 P113 N115 K116 R118 P134 Y135

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
• PDBsum: 3j6b
• PubMed: 24675956
• UniProt: Q12487|RM23_YEAST Large ribosomal subunit protein uL13m (Gene Name=MRPL23)