Structure of PDB 3iyd Chain H

Receptor sequence

>3iydH (length=201) Species: 83333 (Escherichia coli K-12)

PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGT
R

3D structure

• PDB: 3iyd Three-dimensional EM structure of an intact activator-dependent transcription initiation complex
• Chain: H
• Resolution: 19.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	H	E58 T168 R169 Q170 K188	E50 T160 R161 Q162 K180
BS02	dna	H	S25 K26 T90 D138 V139 C178 K201	S17 K18 T82 D130 V131 C170 K193
BS03	CMP	H	S62 G71 E72 L73 S83	S54 G63 E64 L65 S75

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003680 minor groove of adenine-thymine-rich DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0008301 DNA binding, bending
• GO:0030552 cAMP binding
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045013 carbon catabolite repression of transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3iyd, PDBe:3iyd, PDBj:3iyd
• PDBsum: 3iyd
• PubMed: 19903881
• UniProt: P0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)