Structure of PDB 3iam Chain H

Receptor sequence

>3iamH (length=127) Species: 300852 (Thermus thermophilus HB8)

ASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPT
TIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKG
LVTGKIPLTKERFFALADRAREALAFA

3D structure

• PDB: 3iam Structural basis for the mechanism of respiratory complex I
• Chain: H
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	H	E32 G64	E30 G62

Gene Ontology

Molecular Function

• GO:0008199 ferric iron binding
• GO:0048038 quinone binding

Biological Process

• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:3iam, PDBe:3iam, PDBj:3iam
• PDBsum: 3iam
• PubMed: 19635800
• UniProt: Q5SKZ7|NQO15_THET8 NADH-quinone oxidoreductase subunit 15 (Gene Name=nqo15)