Structure of PDB 3hni Chain H

Receptor sequence

>3hniH (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 3hni Metal templated design of protein interfaces.
• Chain: H
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	H	E4 M7 E8 N11 P46 F61 F65 C98 C101 H102 R106	E4 M7 E8 N11 P46 F61 F65 C98 C101 H102 R106
BS02	ZN	H	H73 H77	H73 H77

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3hni, PDBe:3hni, PDBj:3hni
• PDBsum: 3hni
• PubMed: 20080561
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)