Structure of PDB 3g4s Chain H

Receptor sequence

>3g4sH (length=160) Species: 2238 (Haloarcula marismortui)

KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLI
VEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKD
GMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSC
RIKVERGEEL

3D structure

• PDB: 3g4s U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
• Chain: H
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K4 A6 M8 R10 K14 P15 A16 Y17 T18 R19 R20 E21 Y22 K35 Q40 R61 S64 A67 R91 K92 F93 H95 R99 E100 M116 R117 A119 F120 R154 R155 Y157 N158 K159 T161 S163	K1 A3 M5 R7 K11 P12 A13 Y14 T15 R16 R17 E18 Y19 K32 Q37 R58 S61 A64 R88 K89 F90 H92 R96 E97 M102 R103 A105 F106 R140 R141 Y143 N144 K145 T147 S149

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3g4s, PDBe:3g4s, PDBj:3g4s
• PDBsum: 3g4s
• PubMed: 19362093
• UniProt: P60617|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)