Structure of PDB 3ejd Chain H

Receptor sequence

>3ejdH (length=382) Species: 1423 (Bacillus subtilis)

ASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARF
KVRTPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTES
YQPYIIETVHHLLDQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQ
LKEWAASLIQTIDFTRSRKALTEGNIMAVQAMAYFKELIQKRKRHPQQDM
ISMLLKGDKLTEEEAASTCILLAIAGHETTVNLISNSVLCLLQHPEQLLK
LRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTIRQGEQVYLLL
GAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLNLADWRYRPLFGFRALEELPVTF

3D structure

• PDB: 3ejd Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
• Chain: H
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Q166 A234 E237 T238 T239 C344 L345 G346 E353 F383
• Catalytic site (residue number reindexed from 1): Q160 A225 E228 T229 T230 C335 L336 G337 E344 F372
• Enzyme Commision number: 1.14.14.46: pimeloyl-[acyl-carrier protein] synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZMQ	H	Y36 R59 P61 P63 I168 I233 A234 T284 Y306	Y30 R53 P55 P57 I162 I224 A225 T275 Y297
BS02	HEM	H	M80 L81 H88 R92 A234 T238 T239 P280 T284 R286 S336 F337 H342 C344 L345 G346 L349 A350	M74 L75 H82 R86 A225 T229 T230 P271 T275 R277 S327 F328 H333 C335 L336 G337 L340 A341

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009102 biotin biosynthetic process

External links

• PDB: RCSB:3ejd, PDBe:3ejd, PDBj:3ejd
• PDBsum: 3ejd
• PubMed: 18838690
• UniProt: P53554|BIOI_BACSU Biotin biosynthesis cytochrome P450 (Gene Name=bioI)