Structure of PDB 3blw Chain H

Receptor sequence

>3blwH (length=346) Species: 4932 (Saccharomyces cerevisiae)

QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWE
SCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPHRSLNLTLRKTFG
LFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIK
LITRDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELS
KEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLS
AGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNH
MGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL

3D structure

• PDB: 3blw Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
• Chain: H
• Resolution: 4.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y142 K189 D222 D248 D252
• Catalytic site (residue number reindexed from 1): Y134 K181 D214 D240 D244
• Enzyme Commision number: 1.1.1.41: isocitrate dehydrogenase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FLC	H	K189 T191	K181 T183

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004449 isocitrate dehydrogenase (NAD+) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding
• GO:0051287 NAD binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006102 isocitrate metabolic process
• GO:0006537 glutamate biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0045242 isocitrate dehydrogenase complex (NAD+)

External links

• PDB: RCSB:3blw, PDBe:3blw, PDBj:3blw
• PDBsum: 3blw
• PubMed: 18256028
• UniProt: P28241|IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial (Gene Name=IDH2)