Structure of PDB 3biv Chain H

Receptor sequence

>3bivH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 3biv Thermodynamic Inhibition Profile of a Cyclopentyl and a Cyclohexyl Derivative towards Thrombin: The Same but for Different Reasons
• Chain: H
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 S48 D116 H119 P120 C122 Q131 Y134 K135 R137 N159 M201 K202 R206 W207	E8 G10 M11 P13 W14 S34 D113 H116 P117 C119 Q131 Y134 K135 R137 N157 M204 K205 R211 W212
BS02	peptide	H	F34 Q38 L65 R67 T74 R75 Y76 K81 I82 M84	F19 Q24 L60 R62 T69 R70 Y71 K77 I78 M80
BS03	11U	H	H57 Y60A W60D L99 D189 A190 V213 W215 G216	H43 Y47 W50 L96 D192 A193 V218 W220 G221	BindingDB: Ki=56100nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3biv, PDBe:3biv, PDBj:3biv
• PDBsum: 3biv
• PubMed: 17902081
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)