Structure of PDB 2zjp Chain H

Receptor sequence
>2zjpH (length=134) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDI
IVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIIN
NQGEPRGTRVFGPVARELRDRRFMKIVSLAPEVL
3D structure
PDB2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
ChainH
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H M1 M3 Q5 S6 I22 R23 G31 T35 T36 G37 G38 G39 G40 N41 K42 R43 Y44 K56 V69 K82 R90 M1 M3 Q5 S6 I22 R23 G31 T35 T36 G37 G38 G39 G40 N41 K42 R43 Y44 K56 V69 K82 R90
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
PDBsum2zjp
PubMed18406324
UniProtQ9RXJ2|RL14_DEIRA Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]